Edit and Resubmit [Sign in above to save your search strategy] Formatting options Download

Formatting options
Show	as Advanced View Use old BLAST report format Reset form to defaults [?]
Alignment View	[?]
Display	Graphical Overview Linkout Sequence Retrieval NCBI-gi CDS feature [?]
Masking	Character: Color: [?]
Limit results	Descriptions: Graphical overview: Alignments: [?]
	Organism Type common name, binomial, taxid, or group name. Only 20 top taxa will be shown. Exclude [?]
	Entrez query: [?]
	Expect Min: Expect Max: [?]
	Percent Identity Min: Percent Identity Max: [?]
Format for	PSI-BLAST with inclusion threshold: [?] Format for PSI-BLAST: The Position-Specific Iterated BLAST (PSI-BLAST) program performs iterative searches with a protein query, in which sequences found in one round of search are used to build a custom score model for the next round. more... Inclusion Threshold: This sets the statistical significance threshold for including a sequence in the model used by PSI-BLAST to create the PSSM on the next iteration.

Download
Alignment Text XML ASN.1 Hit Table(text) Hit Table(csv)	Search Strategies ASN.1	Bioseq ASN.1	PssmWithParameters ASN.1	[?]

The Download link provides BLAST output that may be used as input to another program. This includes parseable formats such as the tabular report or XML as well as the Search Strategy files read by the BLAST+ applications. More details on the parseable (XML, tabular, and ASN.1) reports can be found at http://www.ncbi.nlm.nih.gov/books/NBK21097/

The following formats are offered under the Alignment section:
1). "Text". Non-HTML standard BLAST report.
2). "XML". XML report based upon the DTD at http://www.ncbi.nlm.nih.gov/data_specs/dtd/NCBI_BlastOutput.dtd
3). "ASN.1" Alignment. This is the alignment written out in Abstract Syntax Notation 1.
4). "Hit Table(text)". The tabular report as text.
5). "Hit Table(csv)". The tabular report ready for import into spread-sheet programs like Excel.

The following report is offered under the Search Strategy section:
1). "ASN.1" Search Strategy. A record of the parameters, query, and database used in the search. This file can be used to start a stand-alone BLAST search, see http://www.ncbi.nlm.nih.gov/books/NBK1763/#CmdLineAppsManual.I455_BLAST_search_stra

The following report is offered under the Bioseq section:
1). "ASN.1". The query sequence in ASN.1

Protein Sequence (292 letters)

Query ID: lcl|18779; lcl|18779
Description: None
Molecule type: amino acid
Query Length: 292

Database Name: pdb
Description: PDB protein database See details
Program: BLASTP 2.2.25+ Citation

Other reports: Search Summary [Distance tree of results] [Related Structures] [Multiple alignment]

Search Parameters
Search parameter name	Search parameter value
Program	blastp
Word size	3
Expect value	10
Hitlist size	100
Gapcosts	11,1
Matrix	BLOSUM62
Filter string	F
Genetic Code	1
Window Size	40
Threshold	11
Composition-based stats	2

Database
Database parameter name	Database parameter value
Posted date	Oct 24, 2011 4:44 PM
Number of letters	12,844,533
Number of sequences	54,582
Entrez query	none

Karlin-Altschul statistics
Params	Ungapped	Gapped
Lambda	0.323736	0.267
K	0.13998	0.041
H	0.463362	0.14

Results Statistics
Results Statistics parameter name	Results Statistics parameter value
Length adjustment	97
Effective length of query	195
Effective length of database	7550079
Effective search space	1472265405
Effective search space used	1472265405

Descriptions

Legend for links to other resources:

UniGene

GEO

Gene

Structure

Map Viewer

PubChem BioAssay

Sequences producing significant alignments:
Accession	Description	Max score	Total score	Query coverage	E value
2VU5_A	Chain A, Crystal Structure Of Pndk From Bacillus Anthracis	29.6	29.6	22%	1.2
2WXF_A	Chain A, The Crystal Structure Of The Murine Class Ia Pi 3-Kinase P110delta In Complex With Pik-39 >pdb\|2WXG\|A Chain A, The Crystal Structure Of The Murine Class Ia Pi 3-Kinase P110delta In Complex With Sw13. >pdb\|2WXH\|A Chain A, The Crystal Structure Of The Murine Class Ia Pi 3-Kinase P110delta In Complex With Sw14. >pdb\|2WXI\|A Chain A, The Crystal Structure Of The Murine Class Ia Pi 3-Kinase P110delta In Complex With Sw30. >pdb\|2WXJ\|A Chain A, The Crystal Structure Of The Murine Class Ia Pi 3-Kinase P110delta In Complex With Ink654. >pdb\|2WXK\|A Chain A, The Crystal Structure Of The Murine Class Ia Pi 3-Kinase P110delta In Complex With Ink666. >pdb\|2WXL\|A Chain A, The Crystal Structure Of The Murine Class Ia Pi 3-Kinase P110delta In Complex With Zstk474. >pdb\|2WXM\|A Chain A, The Crystal Structure Of The Murine Class Ia Pi 3-Kinase P110delta In Complex With Dl06. >pdb\|2WXN\|A Chain A, The Crystal Structure Of The Murine Class Ia Pi 3-Kinase P110delta In Complex With Dl07. >pdb\|2WXO\|A Chain A, The Crystal Structure Of The Murine Class Ia Pi 3-Kinase P110delta In Complex With As5. >pdb\|2WXP\|A Chain A, The Crystal Structure Of The Murine Class Ia Pi 3-Kinase P110delta In Complex With Gdc-0941. >pdb\|2WXQ\|A Chain A, The Crystal Structure Of The Murine Class Ia Pi 3-Kinase P110delta In Complex With As15. >pdb\|2WXR\|A Chain A, The Crystal Structure Of The Murine Class Ia Pi 3-Kinase P110delta. >pdb\|2X38\|A Chain A, The Crystal Structure Of The Murine Class Ia Pi 3-Kinase P110delta In Complex With Ic87114.	28.5	28.5	13%	6.5
2CF7_A	Chain A, Asp74ala Mutant Crystal Structure For Dps-Like Peroxide Resistance Protein Dpr From Streptococcus Suis >pdb\|2CF7\|B Chain B, Asp74ala Mutant Crystal Structure For Dps-Like Peroxide Resistance Protein Dpr From Streptococcus Suis. >pdb\|2CF7\|C Chain C, Asp74ala Mutant Crystal Structure For Dps-Like Peroxide Resistance Protein Dpr From Streptococcus Suis. >pdb\|2CF7\|D Chain D, Asp74ala Mutant Crystal Structure For Dps-Like Peroxide Resistance Protein Dpr From Streptococcus Suis. >pdb\|2CF7\|E Chain E, Asp74ala Mutant Crystal Structure For Dps-Like Peroxide Resistance Protein Dpr From Streptococcus Suis. >pdb\|2CF7\|F Chain F, Asp74ala Mutant Crystal Structure For Dps-Like Peroxide Resistance Protein Dpr From Streptococcus Suis. >pdb\|2CF7\|G Chain G, Asp74ala Mutant Crystal Structure For Dps-Like Peroxide Resistance Protein Dpr From Streptococcus Suis. >pdb\|2CF7\|H Chain H, Asp74ala Mutant Crystal Structure For Dps-Like Peroxide Resistance Protein Dpr From Streptococcus Suis. >pdb\|2CF7\|I Chain I, Asp74ala Mutant Crystal Structure For Dps-Like Peroxide Resistance Protein Dpr From Streptococcus Suis. >pdb\|2CF7\|J Chain J, Asp74ala Mutant Crystal Structure For Dps-Like Peroxide Resistance Protein Dpr From Streptococcus Suis. >pdb\|2CF7\|K Chain K, Asp74ala Mutant Crystal Structure For Dps-Like Peroxide Resistance Protein Dpr From Streptococcus Suis. >pdb\|2CF7\|L Chain L, Asp74ala Mutant Crystal Structure For Dps-Like Peroxide Resistance Protein Dpr From Streptococcus Suis.	27.3	27.3	11%	8.4
1UMN_A	Chain A, Crystal Structure Of Dps-Like Peroxide Resistance Protein (Dpr) From Streptococcus Suis >pdb\|1UMN\|B Chain B, Crystal Structure Of Dps-Like Peroxide Resistance Protein (Dpr) From Streptococcus Suis >pdb\|1UMN\|C Chain C, Crystal Structure Of Dps-Like Peroxide Resistance Protein (Dpr) From Streptococcus Suis >pdb\|1UMN\|D Chain D, Crystal Structure Of Dps-Like Peroxide Resistance Protein (Dpr) From Streptococcus Suis >pdb\|1UMN\|E Chain E, Crystal Structure Of Dps-Like Peroxide Resistance Protein (Dpr) From Streptococcus Suis >pdb\|1UMN\|F Chain F, Crystal Structure Of Dps-Like Peroxide Resistance Protein (Dpr) From Streptococcus Suis >pdb\|1UMN\|G Chain G, Crystal Structure Of Dps-Like Peroxide Resistance Protein (Dpr) From Streptococcus Suis >pdb\|1UMN\|H Chain H, Crystal Structure Of Dps-Like Peroxide Resistance Protein (Dpr) From Streptococcus Suis >pdb\|1UMN\|I Chain I, Crystal Structure Of Dps-Like Peroxide Resistance Protein (Dpr) From Streptococcus Suis >pdb\|1UMN\|J Chain J, Crystal Structure Of Dps-Like Peroxide Resistance Protein (Dpr) From Streptococcus Suis >pdb\|1UMN\|K Chain K, Crystal Structure Of Dps-Like Peroxide Resistance Protein (Dpr) From Streptococcus Suis >pdb\|1UMN\|L Chain L, Crystal Structure Of Dps-Like Peroxide Resistance Protein (Dpr) From Streptococcus Suis >pdb\|2V15\|A Chain A, Terbium Binding In Streptococcus Suis Dpr Protein >pdb\|2V15\|B Chain B, Terbium Binding In Streptococcus Suis Dpr Protein >pdb\|2V15\|C Chain C, Terbium Binding In Streptococcus Suis Dpr Protein >pdb\|2V15\|D Chain D, Terbium Binding In Streptococcus Suis Dpr Protein >pdb\|2V15\|E Chain E, Terbium Binding In Streptococcus Suis Dpr Protein >pdb\|2V15\|F Chain F, Terbium Binding In Streptococcus Suis Dpr Protein >pdb\|2V15\|G Chain G, Terbium Binding In Streptococcus Suis Dpr Protein >pdb\|2V15\|H Chain H, Terbium Binding In Streptococcus Suis Dpr Protein >pdb\|2V15\|I Chain I, Terbium Binding In Streptococcus Suis Dpr Protein >pdb\|2V15\|J Chain J, Terbium Binding In Streptococcus Suis Dpr Protein >pdb\|2V15\|K Chain K, Terbium Binding In Streptococcus Suis Dpr Protein >pdb\|2V15\|L Chain L, Terbium Binding In Streptococcus Suis Dpr Protein >pdb\|2XJM\|A Chain A, Crystal Structure Of Streptococcus Suis Dpr With Cobalt >pdb\|2XJM\|B Chain B, Crystal Structure Of Streptococcus Suis Dpr With Cobalt >pdb\|2XJM\|C Chain C, Crystal Structure Of Streptococcus Suis Dpr With Cobalt >pdb\|2XJM\|D Chain D, Crystal Structure Of Streptococcus Suis Dpr With Cobalt >pdb\|2XJM\|E Chain E, Crystal Structure Of Streptococcus Suis Dpr With Cobalt >pdb\|2XJM\|F Chain F, Crystal Structure Of Streptococcus Suis Dpr With Cobalt >pdb\|2XJM\|G Chain G, Crystal Structure Of Streptococcus Suis Dpr With Cobalt >pdb\|2XJM\|H Chain H, Crystal Structure Of Streptococcus Suis Dpr With Cobalt >pdb\|2XJM\|I Chain I, Crystal Structure Of Streptococcus Suis Dpr With Cobalt >pdb\|2XJM\|J Chain J, Crystal Structure Of Streptococcus Suis Dpr With Cobalt >pdb\|2XJM\|K Chain K, Crystal Structure Of Streptococcus Suis Dpr With Cobalt >pdb\|2XJM\|L Chain L, Crystal Structure Of Streptococcus Suis Dpr With Cobalt >pdb\|2XJN\|A Chain A, Crystal Structure Of Streptococcus Suis Dpr With Copper >pdb\|2XJN\|B Chain B, Crystal Structure Of Streptococcus Suis Dpr With Copper >pdb\|2XJN\|C Chain C, Crystal Structure Of Streptococcus Suis Dpr With Copper >pdb\|2XJN\|D Chain D, Crystal Structure Of Streptococcus Suis Dpr With Copper >pdb\|2XJN\|E Chain E, Crystal Structure Of Streptococcus Suis Dpr With Copper >pdb\|2XJN\|F Chain F, Crystal Structure Of Streptococcus Suis Dpr With Copper >pdb\|2XJN\|G Chain G, Crystal Structure Of Streptococcus Suis Dpr With Copper >pdb\|2XJN\|H Chain H, Crystal Structure Of Streptococcus Suis Dpr With Copper >pdb\|2XJN\|I Chain I, Crystal Structure Of Streptococcus Suis Dpr With Copper >pdb\|2XJN\|J Chain J, Crystal Structure Of Streptococcus Suis Dpr With Copper >pdb\|2XJN\|K Chain K, Crystal Structure Of Streptococcus Suis Dpr With Copper >pdb\|2XJN\|L Chain L, Crystal Structure Of Streptococcus Suis Dpr With Copper >pdb\|2XJO\|A Chain A, Crystal Structure Of Streptococcus Suis Dpr With Nickel >pdb\|2XJO\|B Chain B, Crystal Structure Of Streptococcus Suis Dpr With Nickel >pdb\|2XJO\|C Chain C, Crystal Structure Of Streptococcus Suis Dpr With Nickel >pdb\|2XJO\|D Chain D, Crystal Structure Of Streptococcus Suis Dpr With Nickel >pdb\|2XJO\|E Chain E, Crystal Structure Of Streptococcus Suis Dpr With Nickel >pdb\|2XJO\|F Chain F, Crystal Structure Of Streptococcus Suis Dpr With Nickel >pdb\|2XJO\|G Chain G, Crystal Structure Of Streptococcus Suis Dpr With Nickel >pdb\|2XJO\|H Chain H, Crystal Structure Of Streptococcus Suis Dpr With Nickel >pdb\|2XJO\|I Chain I, Crystal Structure Of Streptococcus Suis Dpr With Nickel >pdb\|2XJO\|J Chain J, Crystal Structure Of Streptococcus Suis Dpr With Nickel >pdb\|2XJO\|K Chain K, Crystal Structure Of Streptococcus Suis Dpr With Nickel >pdb\|2XJO\|L Chain L, Crystal Structure Of Streptococcus Suis Dpr With Nickel >pdb\|2XKQ\|A Chain A, Crystal Structure Of Streptococcus Suis Dpr With Manganese >pdb\|2XKQ\|B Chain B, Crystal Structure Of Streptococcus Suis Dpr With Manganese >pdb\|2XKQ\|C Chain C, Crystal Structure Of Streptococcus Suis Dpr With Manganese >pdb\|2XKQ\|D Chain D, Crystal Structure Of Streptococcus Suis Dpr With Manganese >pdb\|2XKQ\|E Chain E, Crystal Structure Of Streptococcus Suis Dpr With Manganese >pdb\|2XKQ\|F Chain F, Crystal Structure Of Streptococcus Suis Dpr With Manganese >pdb\|2XKQ\|G Chain G, Crystal Structure Of Streptococcus Suis Dpr With Manganese >pdb\|2XKQ\|H Chain H, Crystal Structure Of Streptococcus Suis Dpr With Manganese >pdb\|2XKQ\|I Chain I, Crystal Structure Of Streptococcus Suis Dpr With Manganese >pdb\|2XKQ\|J Chain J, Crystal Structure Of Streptococcus Suis Dpr With Manganese >pdb\|2XKQ\|K Chain K, Crystal Structure Of Streptococcus Suis Dpr With Manganese >pdb\|2XKQ\|L Chain L, Crystal Structure Of Streptococcus Suis Dpr With Manganese	27.3	27.3	11%	8.6
2BW1_A	Chain A, Iron-Bound Crystal Structure Of Dps-Like Peroxide Resistance Protein (Dpr) From Streptococcus Suis >pdb\|2BW1\|B Chain B, Iron-Bound Crystal Structure Of Dps-Like Peroxide Resistance Protein (Dpr) From Streptococcus Suis. >pdb\|2BW1\|C Chain C, Iron-Bound Crystal Structure Of Dps-Like Peroxide Resistance Protein (Dpr) From Streptococcus Suis. >pdb\|2BW1\|D Chain D, Iron-Bound Crystal Structure Of Dps-Like Peroxide Resistance Protein (Dpr) From Streptococcus Suis. >pdb\|2BW1\|E Chain E, Iron-Bound Crystal Structure Of Dps-Like Peroxide Resistance Protein (Dpr) From Streptococcus Suis. >pdb\|2BW1\|F Chain F, Iron-Bound Crystal Structure Of Dps-Like Peroxide Resistance Protein (Dpr) From Streptococcus Suis. >pdb\|2BW1\|G Chain G, Iron-Bound Crystal Structure Of Dps-Like Peroxide Resistance Protein (Dpr) From Streptococcus Suis. >pdb\|2BW1\|H Chain H, Iron-Bound Crystal Structure Of Dps-Like Peroxide Resistance Protein (Dpr) From Streptococcus Suis. >pdb\|2BW1\|I Chain I, Iron-Bound Crystal Structure Of Dps-Like Peroxide Resistance Protein (Dpr) From Streptococcus Suis. >pdb\|2BW1\|J Chain J, Iron-Bound Crystal Structure Of Dps-Like Peroxide Resistance Protein (Dpr) From Streptococcus Suis. >pdb\|2BW1\|K Chain K, Iron-Bound Crystal Structure Of Dps-Like Peroxide Resistance Protein (Dpr) From Streptococcus Suis. >pdb\|2BW1\|L Chain L, Iron-Bound Crystal Structure Of Dps-Like Peroxide Resistance Protein (Dpr) From Streptococcus Suis. >pdb\|2UX1\|A Chain A, Identification Of Two Zinc-Binding Sites In The Streptococcus Suis Dpr Protein >pdb\|2UX1\|B Chain B, Identification Of Two Zinc-Binding Sites In The Streptococcus Suis Dpr Protein >pdb\|2UX1\|C Chain C, Identification Of Two Zinc-Binding Sites In The Streptococcus Suis Dpr Protein >pdb\|2UX1\|D Chain D, Identification Of Two Zinc-Binding Sites In The Streptococcus Suis Dpr Protein >pdb\|2UX1\|E Chain E, Identification Of Two Zinc-Binding Sites In The Streptococcus Suis Dpr Protein >pdb\|2UX1\|F Chain F, Identification Of Two Zinc-Binding Sites In The Streptococcus Suis Dpr Protein >pdb\|2UX1\|G Chain G, Identification Of Two Zinc-Binding Sites In The Streptococcus Suis Dpr Protein >pdb\|2UX1\|H Chain H, Identification Of Two Zinc-Binding Sites In The Streptococcus Suis Dpr Protein >pdb\|2UX1\|I Chain I, Identification Of Two Zinc-Binding Sites In The Streptococcus Suis Dpr Protein >pdb\|2UX1\|J Chain J, Identification Of Two Zinc-Binding Sites In The Streptococcus Suis Dpr Protein >pdb\|2UX1\|K Chain K, Identification Of Two Zinc-Binding Sites In The Streptococcus Suis Dpr Protein >pdb\|2UX1\|L Chain L, Identification Of Two Zinc-Binding Sites In The Streptococcus Suis Dpr Protein	27.3	27.3	11%	9.0

Alignments

Select All Get selected sequences


>pdb|2VU5|A  Chain A, Crystal Structure Of Pndk From Bacillus Anthracis
Length=148

 Score = 29.6 bits (65),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 21/66 (32%), Positives = 30/66 (45%), Gaps = 2/66 (3%)

Query  91   KLMRWTPAAADICFTKELHSHFFSLGKCVPVCRGAEFFQAENEGKGVLDTGRHMPGAGKR  150
            KLM+ TP  A   + +     FF  G+ V        F    +G+GV+DT R+M G  + 
Sbjct  36   KLMQVTPEIAGQHYAEHEEKPFF--GELVDFITSGPVFAMVWQGEGVVDTARNMMGKTRP  93

Query  151  REKGDG  156
             E   G
Sbjct  94   HEAAPG  99


>pdb|2WXF|A  Chain A, The Crystal Structure Of The Murine Class Ia Pi 3-Kinase 
P110delta In Complex With Pik-39.
 pdb|2WXG|A  Chain A, The Crystal Structure Of The Murine Class Ia Pi 3-Kinase 
P110delta In Complex With Sw13.
 pdb|2WXH|A  Chain A, The Crystal Structure Of The Murine Class Ia Pi 3-Kinase 
P110delta In Complex With Sw14.
 11 more sequence titles
 pdb|2WXI|A  Chain A, The Crystal Structure Of The Murine Class Ia Pi 3-Kinase 
P110delta In Complex With Sw30.
 pdb|2WXJ|A  Chain A, The Crystal Structure Of The Murine Class Ia Pi 3-Kinase 
P110delta In Complex With Ink654.
 pdb|2WXK|A  Chain A, The Crystal Structure Of The Murine Class Ia Pi 3-Kinase 
P110delta In Complex With Ink666.
 pdb|2WXL|A  Chain A, The Crystal Structure Of The Murine Class Ia Pi 3-Kinase 
P110delta In Complex With Zstk474.
 pdb|2WXM|A  Chain A, The Crystal Structure Of The Murine Class Ia Pi 3-Kinase 
P110delta In Complex With Dl06.
 pdb|2WXN|A  Chain A, The Crystal Structure Of The Murine Class Ia Pi 3-Kinase 
P110delta In Complex With Dl07.
 pdb|2WXO|A  Chain A, The Crystal Structure Of The Murine Class Ia Pi 3-Kinase 
P110delta In Complex With As5.
 pdb|2WXP|A  Chain A, The Crystal Structure Of The Murine Class Ia Pi 3-Kinase 
P110delta In Complex With Gdc-0941.
 pdb|2WXQ|A  Chain A, The Crystal Structure Of The Murine Class Ia Pi 3-Kinase 
P110delta In Complex With As15.
 pdb|2WXR|A  Chain A, The Crystal Structure Of The Murine Class Ia Pi 3-Kinase 
P110delta.
 pdb|2X38|A  Chain A, The Crystal Structure Of The Murine Class Ia Pi 3-Kinase 
P110delta In Complex With Ic87114.
Length=940

 Score = 28.5 bits (62),  Expect = 6.5, Method: Compositional matrix adjust.
 Identities = 14/38 (37%), Positives = 23/38 (61%), Gaps = 4/38 (11%)

Query  156  GVYQKGMDFILEKLNHGDWVHIFPEGKVNMSSEFLRFK  193
            G+ ++ + FIL      D+VH+  +GK N S +F RF+
Sbjct  820  GINRERVPFILTY----DFVHVIQQGKTNNSEKFERFR  853


>pdb|2CF7|A  Chain A, Asp74ala Mutant Crystal Structure For Dps-Like Peroxide 
Resistance Protein Dpr From Streptococcus Suis.
 pdb|2CF7|B  Chain B, Asp74ala Mutant Crystal Structure For Dps-Like Peroxide 
Resistance Protein Dpr From Streptococcus Suis.
 pdb|2CF7|C  Chain C, Asp74ala Mutant Crystal Structure For Dps-Like Peroxide 
Resistance Protein Dpr From Streptococcus Suis.
 9 more sequence titles
 pdb|2CF7|D  Chain D, Asp74ala Mutant Crystal Structure For Dps-Like Peroxide 
Resistance Protein Dpr From Streptococcus Suis.
 pdb|2CF7|E  Chain E, Asp74ala Mutant Crystal Structure For Dps-Like Peroxide 
Resistance Protein Dpr From Streptococcus Suis.
 pdb|2CF7|F  Chain F, Asp74ala Mutant Crystal Structure For Dps-Like Peroxide 
Resistance Protein Dpr From Streptococcus Suis.
 pdb|2CF7|G  Chain G, Asp74ala Mutant Crystal Structure For Dps-Like Peroxide 
Resistance Protein Dpr From Streptococcus Suis.
 pdb|2CF7|H  Chain H, Asp74ala Mutant Crystal Structure For Dps-Like Peroxide 
Resistance Protein Dpr From Streptococcus Suis.
 pdb|2CF7|I  Chain I, Asp74ala Mutant Crystal Structure For Dps-Like Peroxide 
Resistance Protein Dpr From Streptococcus Suis.
 pdb|2CF7|J  Chain J, Asp74ala Mutant Crystal Structure For Dps-Like Peroxide 
Resistance Protein Dpr From Streptococcus Suis.
 pdb|2CF7|K  Chain K, Asp74ala Mutant Crystal Structure For Dps-Like Peroxide 
Resistance Protein Dpr From Streptococcus Suis.
 pdb|2CF7|L  Chain L, Asp74ala Mutant Crystal Structure For Dps-Like Peroxide 
Resistance Protein Dpr From Streptococcus Suis.
Length=165

 Score = 27.3 bits (59),  Expect = 8.4, Method: Compositional matrix adjust.
 Identities = 10/35 (29%), Positives = 17/35 (49%), Gaps = 0/35 (0%)

Query  212  LWHVGMNDVLPNSPPYFPRFGQKITVLIGKPFSAL  246
            +WH  M++ +     Y     +++  L G PFS L
Sbjct  50   IWHPKMDEYMEEIDGYLAEMSERLITLGGAPFSTL  84


>pdb|1UMN|A  Chain A, Crystal Structure Of Dps-Like Peroxide Resistance Protein 
(Dpr) From Streptococcus Suis
 pdb|1UMN|B  Chain B, Crystal Structure Of Dps-Like Peroxide Resistance Protein 
(Dpr) From Streptococcus Suis
 pdb|1UMN|C  Chain C, Crystal Structure Of Dps-Like Peroxide Resistance Protein 
(Dpr) From Streptococcus Suis
 69 more sequence titles
 pdb|1UMN|D  Chain D, Crystal Structure Of Dps-Like Peroxide Resistance Protein 
(Dpr) From Streptococcus Suis
 pdb|1UMN|E  Chain E, Crystal Structure Of Dps-Like Peroxide Resistance Protein 
(Dpr) From Streptococcus Suis
 pdb|1UMN|F  Chain F, Crystal Structure Of Dps-Like Peroxide Resistance Protein 
(Dpr) From Streptococcus Suis
 pdb|1UMN|G  Chain G, Crystal Structure Of Dps-Like Peroxide Resistance Protein 
(Dpr) From Streptococcus Suis
 pdb|1UMN|H  Chain H, Crystal Structure Of Dps-Like Peroxide Resistance Protein 
(Dpr) From Streptococcus Suis
 pdb|1UMN|I  Chain I, Crystal Structure Of Dps-Like Peroxide Resistance Protein 
(Dpr) From Streptococcus Suis
 pdb|1UMN|J  Chain J, Crystal Structure Of Dps-Like Peroxide Resistance Protein 
(Dpr) From Streptococcus Suis
 pdb|1UMN|K  Chain K, Crystal Structure Of Dps-Like Peroxide Resistance Protein 
(Dpr) From Streptococcus Suis
 pdb|1UMN|L  Chain L, Crystal Structure Of Dps-Like Peroxide Resistance Protein 
(Dpr) From Streptococcus Suis
 pdb|2V15|A  Chain A, Terbium Binding In Streptococcus Suis Dpr Protein
 pdb|2V15|B  Chain B, Terbium Binding In Streptococcus Suis Dpr Protein
 pdb|2V15|C  Chain C, Terbium Binding In Streptococcus Suis Dpr Protein
 pdb|2V15|D  Chain D, Terbium Binding In Streptococcus Suis Dpr Protein
 pdb|2V15|E  Chain E, Terbium Binding In Streptococcus Suis Dpr Protein
 pdb|2V15|F  Chain F, Terbium Binding In Streptococcus Suis Dpr Protein
 pdb|2V15|G  Chain G, Terbium Binding In Streptococcus Suis Dpr Protein
 pdb|2V15|H  Chain H, Terbium Binding In Streptococcus Suis Dpr Protein
 pdb|2V15|I  Chain I, Terbium Binding In Streptococcus Suis Dpr Protein
 pdb|2V15|J  Chain J, Terbium Binding In Streptococcus Suis Dpr Protein
 pdb|2V15|K  Chain K, Terbium Binding In Streptococcus Suis Dpr Protein
 pdb|2V15|L  Chain L, Terbium Binding In Streptococcus Suis Dpr Protein
 pdb|2XJM|A  Chain A, Crystal Structure Of Streptococcus Suis Dpr With Cobalt
 pdb|2XJM|B  Chain B, Crystal Structure Of Streptococcus Suis Dpr With Cobalt
 pdb|2XJM|C  Chain C, Crystal Structure Of Streptococcus Suis Dpr With Cobalt
 pdb|2XJM|D  Chain D, Crystal Structure Of Streptococcus Suis Dpr With Cobalt
 pdb|2XJM|E  Chain E, Crystal Structure Of Streptococcus Suis Dpr With Cobalt
 pdb|2XJM|F  Chain F, Crystal Structure Of Streptococcus Suis Dpr With Cobalt
 pdb|2XJM|G  Chain G, Crystal Structure Of Streptococcus Suis Dpr With Cobalt
 pdb|2XJM|H  Chain H, Crystal Structure Of Streptococcus Suis Dpr With Cobalt
 pdb|2XJM|I  Chain I, Crystal Structure Of Streptococcus Suis Dpr With Cobalt
 pdb|2XJM|J  Chain J, Crystal Structure Of Streptococcus Suis Dpr With Cobalt
 pdb|2XJM|K  Chain K, Crystal Structure Of Streptococcus Suis Dpr With Cobalt
 pdb|2XJM|L  Chain L, Crystal Structure Of Streptococcus Suis Dpr With Cobalt
 pdb|2XJN|A  Chain A, Crystal Structure Of Streptococcus Suis Dpr With Copper
 pdb|2XJN|B  Chain B, Crystal Structure Of Streptococcus Suis Dpr With Copper
 pdb|2XJN|C  Chain C, Crystal Structure Of Streptococcus Suis Dpr With Copper
 pdb|2XJN|D  Chain D, Crystal Structure Of Streptococcus Suis Dpr With Copper
 pdb|2XJN|E  Chain E, Crystal Structure Of Streptococcus Suis Dpr With Copper
 pdb|2XJN|F  Chain F, Crystal Structure Of Streptococcus Suis Dpr With Copper
 pdb|2XJN|G  Chain G, Crystal Structure Of Streptococcus Suis Dpr With Copper
 pdb|2XJN|H  Chain H, Crystal Structure Of Streptococcus Suis Dpr With Copper
 pdb|2XJN|I  Chain I, Crystal Structure Of Streptococcus Suis Dpr With Copper
 pdb|2XJN|J  Chain J, Crystal Structure Of Streptococcus Suis Dpr With Copper
 pdb|2XJN|K  Chain K, Crystal Structure Of Streptococcus Suis Dpr With Copper
 pdb|2XJN|L  Chain L, Crystal Structure Of Streptococcus Suis Dpr With Copper
 pdb|2XJO|A  Chain A, Crystal Structure Of Streptococcus Suis Dpr With Nickel
 pdb|2XJO|B  Chain B, Crystal Structure Of Streptococcus Suis Dpr With Nickel
 pdb|2XJO|C  Chain C, Crystal Structure Of Streptococcus Suis Dpr With Nickel
 pdb|2XJO|D  Chain D, Crystal Structure Of Streptococcus Suis Dpr With Nickel
 pdb|2XJO|E  Chain E, Crystal Structure Of Streptococcus Suis Dpr With Nickel
 pdb|2XJO|F  Chain F, Crystal Structure Of Streptococcus Suis Dpr With Nickel
 pdb|2XJO|G  Chain G, Crystal Structure Of Streptococcus Suis Dpr With Nickel
 pdb|2XJO|H  Chain H, Crystal Structure Of Streptococcus Suis Dpr With Nickel
 pdb|2XJO|I  Chain I, Crystal Structure Of Streptococcus Suis Dpr With Nickel
 pdb|2XJO|J  Chain J, Crystal Structure Of Streptococcus Suis Dpr With Nickel
 pdb|2XJO|K  Chain K, Crystal Structure Of Streptococcus Suis Dpr With Nickel
 pdb|2XJO|L  Chain L, Crystal Structure Of Streptococcus Suis Dpr With Nickel
 pdb|2XKQ|A  Chain A, Crystal Structure Of Streptococcus Suis Dpr With Manganese
 pdb|2XKQ|B  Chain B, Crystal Structure Of Streptococcus Suis Dpr With Manganese
 pdb|2XKQ|C  Chain C, Crystal Structure Of Streptococcus Suis Dpr With Manganese
 pdb|2XKQ|D  Chain D, Crystal Structure Of Streptococcus Suis Dpr With Manganese
 pdb|2XKQ|E  Chain E, Crystal Structure Of Streptococcus Suis Dpr With Manganese
 pdb|2XKQ|F  Chain F, Crystal Structure Of Streptococcus Suis Dpr With Manganese
 pdb|2XKQ|G  Chain G, Crystal Structure Of Streptococcus Suis Dpr With Manganese
 pdb|2XKQ|H  Chain H, Crystal Structure Of Streptococcus Suis Dpr With Manganese
 pdb|2XKQ|I  Chain I, Crystal Structure Of Streptococcus Suis Dpr With Manganese
 pdb|2XKQ|J  Chain J, Crystal Structure Of Streptococcus Suis Dpr With Manganese
 pdb|2XKQ|K  Chain K, Crystal Structure Of Streptococcus Suis Dpr With Manganese
 pdb|2XKQ|L  Chain L, Crystal Structure Of Streptococcus Suis Dpr With Manganese
Length=165

 Score = 27.3 bits (59),  Expect = 8.6, Method: Compositional matrix adjust.
 Identities = 10/35 (29%), Positives = 17/35 (49%), Gaps = 0/35 (0%)

Query  212  LWHVGMNDVLPNSPPYFPRFGQKITVLIGKPFSAL  246
            +WH  M++ +     Y     +++  L G PFS L
Sbjct  50   IWHPKMDEYMEEIDGYLDEMSERLITLGGAPFSTL  84


>pdb|2BW1|A  Chain A, Iron-Bound Crystal Structure Of Dps-Like Peroxide Resistance 
Protein (Dpr) From Streptococcus Suis.
 pdb|2BW1|B  Chain B, Iron-Bound Crystal Structure Of Dps-Like Peroxide Resistance 
Protein (Dpr) From Streptococcus Suis.
 pdb|2BW1|C  Chain C, Iron-Bound Crystal Structure Of Dps-Like Peroxide Resistance 
Protein (Dpr) From Streptococcus Suis.
 21 more sequence titles
 pdb|2BW1|D  Chain D, Iron-Bound Crystal Structure Of Dps-Like Peroxide Resistance 
Protein (Dpr) From Streptococcus Suis.
 pdb|2BW1|E  Chain E, Iron-Bound Crystal Structure Of Dps-Like Peroxide Resistance 
Protein (Dpr) From Streptococcus Suis.
 pdb|2BW1|F  Chain F, Iron-Bound Crystal Structure Of Dps-Like Peroxide Resistance 
Protein (Dpr) From Streptococcus Suis.
 pdb|2BW1|G  Chain G, Iron-Bound Crystal Structure Of Dps-Like Peroxide Resistance 
Protein (Dpr) From Streptococcus Suis.
 pdb|2BW1|H  Chain H, Iron-Bound Crystal Structure Of Dps-Like Peroxide Resistance 
Protein (Dpr) From Streptococcus Suis.
 pdb|2BW1|I  Chain I, Iron-Bound Crystal Structure Of Dps-Like Peroxide Resistance 
Protein (Dpr) From Streptococcus Suis.
 pdb|2BW1|J  Chain J, Iron-Bound Crystal Structure Of Dps-Like Peroxide Resistance 
Protein (Dpr) From Streptococcus Suis.
 pdb|2BW1|K  Chain K, Iron-Bound Crystal Structure Of Dps-Like Peroxide Resistance 
Protein (Dpr) From Streptococcus Suis.
 pdb|2BW1|L  Chain L, Iron-Bound Crystal Structure Of Dps-Like Peroxide Resistance 
Protein (Dpr) From Streptococcus Suis.
 pdb|2UX1|A  Chain A, Identification Of Two Zinc-Binding Sites In The Streptococcus 
Suis Dpr Protein
 pdb|2UX1|B  Chain B, Identification Of Two Zinc-Binding Sites In The Streptococcus 
Suis Dpr Protein
 pdb|2UX1|C  Chain C, Identification Of Two Zinc-Binding Sites In The Streptococcus 
Suis Dpr Protein
 pdb|2UX1|D  Chain D, Identification Of Two Zinc-Binding Sites In The Streptococcus 
Suis Dpr Protein
 pdb|2UX1|E  Chain E, Identification Of Two Zinc-Binding Sites In The Streptococcus 
Suis Dpr Protein
 pdb|2UX1|F  Chain F, Identification Of Two Zinc-Binding Sites In The Streptococcus 
Suis Dpr Protein
 pdb|2UX1|G  Chain G, Identification Of Two Zinc-Binding Sites In The Streptococcus 
Suis Dpr Protein
 pdb|2UX1|H  Chain H, Identification Of Two Zinc-Binding Sites In The Streptococcus 
Suis Dpr Protein
 pdb|2UX1|I  Chain I, Identification Of Two Zinc-Binding Sites In The Streptococcus 
Suis Dpr Protein
 pdb|2UX1|J  Chain J, Identification Of Two Zinc-Binding Sites In The Streptococcus 
Suis Dpr Protein
 pdb|2UX1|K  Chain K, Identification Of Two Zinc-Binding Sites In The Streptococcus 
Suis Dpr Protein
 pdb|2UX1|L  Chain L, Identification Of Two Zinc-Binding Sites In The Streptococcus 
Suis Dpr Protein
Length=165

 Score = 27.3 bits (59),  Expect = 9.0, Method: Compositional matrix adjust.
 Identities = 10/35 (29%), Positives = 17/35 (49%), Gaps = 0/35 (0%)

Query  212  LWHVGMNDVLPNSPPYFPRFGQKITVLIGKPFSAL  246
            +WH  M++ +     Y     +++  L G PFS L
Sbjct  50   IWHPKMDEYMEEIDGYLDEMSERLITLGGAPFSTL  84

Select All Get selected sequences

Basic Local Alignment Search Tool

Formatting options

Download

Protein Sequence (292 letters)

Graphic Summary

Distribution of 5 Blast Hits on the Query Sequence [?]

Descriptions

Alignments